LL-37 Cathelicidin Research Overview
Human cathelicidin host-defence peptide studied for antimicrobial activity, immunomodulation, wound healing, angiogenesis, and cancer biology.
Background: The Only Human Cathelicidin
Cathelicidins are a family of antimicrobial peptides found across vertebrates β mice have four (CRAMP and related), cows have numerous (including indolicidin, bactenecin), and pigs have PR-39. Humans have just one: LL-37, derived from the 18-kDa precursor protein hCAP-18 (human cationic antimicrobial protein) encoded by the CAMP (Cathelicidin Antimicrobial Peptide) gene. LL-37 is generated by protease cleavage of hCAP-18 (primarily by serine proteases including proteinase 3 and gastricsin) at sites of inflammation, infection, and epithelial disruption, releasing the active 37-amino acid C-terminal peptide.
The name "LL-37" derives from the two leucine residues at its N-terminus and its 37-amino acid length. Its discovery and functional characterisation in the 1990sβ2000s established it as a central component of human innate immunity β expressed by neutrophils, epithelial cells of the skin, respiratory and gastrointestinal tracts, and macrophages, with expression strongly induced by vitamin Dβ and infection-associated signals. This makes LL-37 a critical bridge between the ancient innate immune system and the more recently evolved adaptive immune response.
- Sequence: [LL-37, 37 aa]
- Molecular Weight: 4,493 Da (37 amino acids)
- Structure: Amphipathic alpha-helix; net charge +6
- Precursor Protein: hCAP-18 (CAMP gene product)
- Primary Expression Sites: Neutrophils, skin, respiratory/GI epithelia, macrophages
- Vitamin D Inducibility: Strong β CAMP gene has functional vitamin D response element
Antimicrobial Mechanism: Membrane Disruption
LL-37's direct antimicrobial activity is mediated by its amphipathic alpha-helical structure β a geometry in which one face of the helix is hydrophilic (positively charged lysine and arginine residues) and the opposite face is hydrophobic (leucine, phenylalanine, isoleucine residues). At bacterial cell membranes β which carry a strong net negative surface charge from lipopolysaccharide (gram-negative) or teichoic acids (gram-positive) β LL-37 is electrostatically attracted and inserts into the lipid bilayer, disrupting its structural integrity through several proposed mechanisms: toroidal pore formation, carpet-model disruption, and detergent-like solubilisation of membrane lipids.
This membrane-targeting mechanism is fundamentally different from conventional antibiotics that target specific bacterial enzymes or ribosomal subunits β and crucially, it is much harder for bacteria to develop resistance to, since resistance would require wholesale changes to bacterial membrane lipid composition rather than a single enzyme mutation. This property makes antimicrobial peptides like LL-37 an active area of antibiotic resistance research.
Antimicrobial Spectrum
- Pathogen Class: Gram-negative bacteria β Representative Organisms: E. coli, P. aeruginosa, K. pneumoniae, H. pylori β MIC Range: 1β64 Β΅g/mL β Notes: LPS binding contributes to both killing and endotoxin neutralisation
- Pathogen Class: Gram-positive bacteria β Representative Organisms: S. aureus, MRSA, S. epidermidis, Enterococcus β MIC Range: 2β128 Β΅g/mL β Notes: Activity against MRSA is particularly research-relevant given AMR crisis
- Pathogen Class: Fungi β Representative Organisms: Candida albicans, C. glabrata β MIC Range: 4β32 Β΅g/mL β Notes: Membrane disruption mechanism applies to fungal membranes; activity reduced by ergosterol
- Pathogen Class: Viruses β Representative Organisms: HIV-1, Influenza A, RSV, HSV-1/2, SARS-CoV-2 β MIC Range: Variable β Notes: Envelope disruption; also inhibits viral attachment to host cells
- Pathogen Class: Biofilms β Representative Organisms: P. aeruginosa, S. aureus, E. coli β MIC Range: 4β128 Β΅g/mL β Notes: Anti-biofilm at sub-MIC; disrupts quorum sensing and matrix integrity
Research Activity Domains
Innate Immunity
Neutralises LPS endotoxin. Induces cytokine production in macrophages and DCs. Recruits neutrophils and monocytes via formyl peptide receptor 2 (FPR2) activation.
Adaptive Immunity
Promotes dendritic cell maturation and Th1/Th17 polarisation. Enhances antigen presentation. Bridges innate to adaptive immune activation via pattern recognition modulation.
Wound Healing
Promotes keratinocyte migration and proliferation via EGFR transactivation. Stimulates fibroblast chemotaxis. Induces VEGF and angiogenesis in wound bed. Re-epithelialisation research.
Anti-Biofilm
Disrupts preformed biofilm matrix. Inhibits biofilm formation at sub-MIC concentrations. Interferes with quorum sensing signals (C12-HSL). Active against MRSA and P. aeruginosa biofilms.
Angiogenesis
Activates FPRL1/FPR2 on endothelial cells driving tube formation. Upregulates VEGF and MMP-9. Studied in ischaemic tissue revascularisation and wound healing models.
Cancer Biology
Context-dependent β promotes proliferation in some cancers (colon, breast) while pro-apoptotic in others. LL-37 expression dysregulation documented across multiple tumour types. Active research area.
Immunomodulatory Mechanisms
LL-37's immunomodulatory activities are mediated through multiple receptor interactions that modulate both innate and adaptive immune responses. Its primary immune receptor is FPR2 (formyl peptide receptor 2 / FPRL1) β a G-protein coupled receptor expressed on neutrophils, macrophages, monocytes, dendritic cells, and endothelial cells. FPR2 activation by LL-37 triggers chemotaxis, degranulation, and cytokine production in these immune cell types, effectively recruiting and activating the cellular arsenal of innate immunity to sites of infection or injury.
LL-37 also binds and neutralises lipopolysaccharide (LPS) from gram-negative bacteria, preventing LPS from engaging TLR4 on macrophages and thereby attenuating the excessive inflammatory cascade that drives septic shock. This LPS-neutralising activity gives LL-37 a potential anti-sepsis role β a research area of significant clinical interest given the mortality burden of gram-negative sepsis and the historical failure of anti-LPS therapeutic approaches.
Vitamin D and CAMP Gene Regulation
One of the most clinically relevant aspects of LL-37 biology is the direct transcriptional regulation of the CAMP gene by 1,25-dihydroxyvitamin Dβ (calcitriol). The CAMP gene promoter contains a functional vitamin D response element (VDRE) that, when occupied by the VDR/RXR transcription factor complex activated by calcitriol, drives CAMP/hCAP-18/LL-37 expression in macrophages, monocytes, and skin keratinocytes. This molecular link between vitamin D status and antimicrobial peptide production provides a mechanistic explanation for the epidemiological associations between vitamin D deficiency and increased susceptibility to respiratory infections β a topic of substantial research and public health interest.
Antimicrobial Resistance Research Context > > LL-37's membrane-disruption antimicrobial mechanism makes it a template for synthetic antimicrobial peptide (AMP) design in the context of the global antimicrobial resistance (AMR) crisis. Bacteria develop resistance to conventional antibiotics through specific enzyme mutations or efflux pump upregulation β mechanisms that do not confer resistance to membrane-disrupting AMPs. LL-37 analogues and mimetics are actively investigated as last-resort antibiotics for multidrug-resistant (MDR) gram-negative pathogens including carbapenem-resistant Enterobacteriaceae (CRE) and MDR P. aeruginosa.
Wound Healing Research
LL-37 promotes wound healing through multiple parallel mechanisms that go beyond its antimicrobial activity. In keratinocyte culture studies, LL-37 stimulates cell migration and proliferation through transactivation of the epidermal growth factor receptor (EGFR) β a receptor whose activation is central to re-epithelialisation. In fibroblast studies, LL-37 acts as a chemoattractant, recruiting fibroblasts into the wound bed and stimulating collagen I production. In the wound vasculature, LL-37 via FPR2 activation on endothelial cells promotes angiogenic tube formation and upregulates VEGF β increasing blood supply to the healing wound. This multi-cellular, multi-mechanistic wound healing activity parallels (and may partly explain) the known role of cathelicidins in cutaneous wound repair in vivo.
Research Use Only. Research Use Only β Disclaimer This document is prepared for laboratory and research reference purposes only. LL-37 is not approved by the FDA for any therapeutic indication. All information pertains to preclinical research models and published scientific literature. This content does not constitute medical advice, diagnosis, or treatment recommendation. Researchers must comply with all applicable institutional and jurisdictional regulations.
References
- Zanetti M. "Cathelicidins, multifunctional peptides of the innate immunity." *J Leukoc Biol*. 2004;75(1):39β48.
- Zasloff M. "Antimicrobial peptides of multicellular organisms." *Nature*. 2002;415(6870):389β395.
- Wang G. "Human antimicrobial peptides and proteins." *Pharmaceuticals (Basel)*. 2014;7(5):545β594.
- Liu PT, et al. "Toll-like receptor triggering of a vitamin D-mediated human antimicrobial response." *Science*. 2006;311(5768):1770β1773.
- Heilborn JD, et al. "The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium." *J Invest Dermatol*. 2003;120(3):379β389.
- Vandamme D, et al. "A comprehensive summary of LL-37, the factotum human cathelicidin peptide." *Cell Immunol*. 2012;280(1):22β35.
Running the numbers for a protocol? Use the research calculators to convert mg, mL, and syringe units.
Related Research Articles
TB-500 Expanded Research Guide 2026
TB-500's G-actin sequestration mechanism is deceptively simple β by binding monomeric actin and redirecting the cell's cytoskeletal dynamics, it promotes cell migration in ways that have proven relevant across tissue repair, cardiac, and neurological research contexts far beyond its original wound healing focus.
GHK-Cu vs BPC-157 Research Comparison 2026
GHK-Cu and BPC-157 are frequently compared because both appear in recovery and skin research β but their mechanisms are so distinct that they address different biological questions entirely, which is why both appear together in the KLOW Blend rather than being treated as alternatives.
KPV Complete Research Guide 2026
KPV is the C-terminal tripeptide of alpha-melanocyte-stimulating hormone, studied for targeted NF-ΞΊB pathway inhibition β a highly specific anti-inflammatory mechanism that distinguishes it from the broader tissue repair effects of BPC-157 and TB-500.
ARA-290 Complete Research Guide 2026
ARA-290 is an 11-amino-acid peptide derived from erythropoietin's three-dimensional structure, designed to activate the innate repair receptor rather than the erythropoietin receptor β separating the tissue-protective and neuroprotective EPO effects from its red blood cell-stimulating activity.
GHK-Cu Complete Research Guide 2026
GHK-Cu (copper peptide) is one of the most mechanistically distinct compounds in the research catalog β its activity is inseparable from the copper coordination chemistry that gives it both its research properties and its unusual stability profile compared to standard amino acid peptides.
BPC-157 vs TB-500 β Which Recovery Peptide to Research in
Researchers comparing BPC-157 and TB-500 often frame it as a choice between two compounds. The more accurate framing is a choice between two mechanisms β and once you understand what each one actually does, the research case for studying both together becomes obvious.
Related Research Materials
Parent Research Hubs
Neutral, moderated research discussion. Laboratory use only.
More compound guides, hubs, and educational research materials.